Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
Domain d4e41a1: 4e41 A:3-81 [220248] Other proteins in same PDB: d4e41a2, d4e41b1, d4e41b2, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f2, d4e41g1, d4e41g2, d4e41i1, d4e41i2, d4e41j1, d4e41j2 automated match to d1jwua2 complexed with na; mutant |
PDB Entry: 4e41 (more details), 2.6 Å
SCOPe Domain Sequences for d4e41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e41a1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d4e41a1: