Lineage for d4e22a_ (4e22 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866355Species Yersinia pseudotuberculosis [TaxId:502800] [226541] (1 PDB entry)
  8. 2866356Domain d4e22a_: 4e22 A: [220164]
    automated match to d2fema_
    complexed with so4

Details for d4e22a_

PDB Entry: 4e22 (more details), 2.32 Å

PDB Description: Structure of cytidine monophosphate kinase from Yersinia pseudotuberculosis
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d4e22a_:

Sequence, based on SEQRES records: (download)

>d4e22a_ c.37.1.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
mtaiapvitvdgpsgagkgtlckalaeslnwrlldsgaiyrvlalaalhhqvdisteeal
vplaahldvrfvsqngqlqvilegedvsneirtetvgntasqaaafprvreallrrqraf
reapgliadgrdmgtivfpdapvkifldassqerahrrmlqlqergfnvnferllaeiqe
rdnrdrnrsvaplvpaadalvldstsmsieqvieqalayaqrila

Sequence, based on observed residues (ATOM records): (download)

>d4e22a_ c.37.1.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
mtaiapvitvdgpsgagkgtlckalaeslnwrlldsgaiyrvlalaalhhqvdisteeal
vplaahldvrfvsqngqlqvilegedvsneirtetvgntasqaaafprvreallrrqraf
reapgliadgrdmgtivfpdapvkifldassqerahrrmlqlqergfnvnferllaeiqp
lvpaadalvldstsmsieqvieqalayaqrila

SCOPe Domain Coordinates for d4e22a_:

Click to download the PDB-style file with coordinates for d4e22a_.
(The format of our PDB-style files is described here.)

Timeline for d4e22a_: