SCOPe 2.03: Domain d4e1lb2: 4e1l B:271-392

Lineage for d4e1lb2 (4e1l B:271-392)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [226291] (2 PDB entries)

8. Domain d4e1lb2: 4e1l B:271-392 [220158]
   automated match to d1ulqa2
   complexed with iod

Details for d4e1lb2

PDB Entry: 4e1l, 2 Å

PDB Description: Crystal structure of Acetoacetyl-CoA thiolase (thlA2) from Clostridium difficile

PDB Compounds: (B:) Acetoacetyl-CoA thiolase 2

SCOPe Domain Sequences for d4e1lb2:

Sequence; same for both SEQRES and ATOM records:

>d4e1lb2 c.95.1.0 (B:271-392) automated matches {Clostridium difficile [TaxId: 272563]}
rplakiksyasagvepevmgtgpipatrkalkkaglsindidlieaneafaaqalavkne
lqidssklnvnggaialghpigasgarilvtliyemqkrkvetglatlcigggqgismvv
sr

Timeline for d4e1lb2:

• d4e1lb2 is new in SCOPe 2.03-stable
  
• d4e1lb2 appears in SCOPe 2.04
  
• d4e1lb2 appears in the current release, SCOPe 2.08