Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (40 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [226291] (2 PDB entries) |
Domain d4e1lb2: 4e1l B:271-392 [220158] automated match to d1ulqa2 complexed with iod |
PDB Entry: 4e1l (more details), 2 Å
SCOPe Domain Sequences for d4e1lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e1lb2 c.95.1.0 (B:271-392) automated matches {Clostridium difficile [TaxId: 272563]} rplakiksyasagvepevmgtgpipatrkalkkaglsindidlieaneafaaqalavkne lqidssklnvnggaialghpigasgarilvtliyemqkrkvetglatlcigggqgismvv sr
Timeline for d4e1lb2: