Lineage for d4e1la2 (4e1l A:271-392)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917566Species Clostridium difficile [TaxId:272563] [226291] (2 PDB entries)
  8. 2917570Domain d4e1la2: 4e1l A:271-392 [220156]
    Other proteins in same PDB: d4e1la3, d4e1lb3, d4e1lc3, d4e1ld3
    automated match to d1ulqa2
    complexed with iod

Details for d4e1la2

PDB Entry: 4e1l (more details), 2 Å

PDB Description: Crystal structure of Acetoacetyl-CoA thiolase (thlA2) from Clostridium difficile
PDB Compounds: (A:) Acetoacetyl-CoA thiolase 2

SCOPe Domain Sequences for d4e1la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1la2 c.95.1.0 (A:271-392) automated matches {Clostridium difficile [TaxId: 272563]}
rplakiksyasagvepevmgtgpipatrkalkkaglsindidlieaneafaaqalavkne
lqidssklnvnggaialghpigasgarilvtliyemqkrkvetglatlcigggqgismvv
sr

SCOPe Domain Coordinates for d4e1la2:

Click to download the PDB-style file with coordinates for d4e1la2.
(The format of our PDB-style files is described here.)

Timeline for d4e1la2: