SCOP 1.65: Domain d1ebaa1: 1eba A:10-116

Lineage for d1ebaa1 (1eba A:10-116)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1ebaa1: 1eba A:10-116 [22015]

Details for d1ebaa1

PDB Entry: 1eba, 2.7 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)

SCOP Domain Sequences for d1ebaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ebaa1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1ebaa1:

• d1ebaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebaa1 appears in SCOP 1.63
  
• d1ebaa1 appears in SCOP 1.67
  
• d1ebaa1 appears in the current release, SCOPe 2.08