Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [226334] (1 PDB entry) |
Domain d4e1jb1: 4e1j B:26-274 [220149] Other proteins in same PDB: d4e1ja3, d4e1jc3 automated match to d1glfo1 complexed with cl, gol, na |
PDB Entry: 4e1j (more details), 2.33 Å
SCOPe Domain Sequences for d4e1jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e1jb1 c.55.1.0 (B:26-274) automated matches {Sinorhizobium meliloti [TaxId: 266834]} gyilaidqgttstraivfdgnqkiagvgqkefkqhfpksgwvehdpeeiwqtvvstvkea ieksgitandiaaigitnqretvvvwdretgkpihnaivwqdrrtaafcdklkkkglekt fvkktgllldpyfsgtklnwllsnvkgaqvraakgelcfgtidtfliwrltggecfctda tnasrtllyniaenawddeltevlrvpkemlpevkdcaadfgvtdpslfgaaipilgvag dqqaatigq
Timeline for d4e1jb1: