Lineage for d4e13a1 (4e13 A:1-189)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830547Species Acinetobacter baylyi [TaxId:202950] [226522] (3 PDB entries)
  8. 1830550Domain d4e13a1: 4e13 A:1-189 [220141]
    Other proteins in same PDB: d4e13a2
    automated match to d1f17a2
    complexed with 1pe, gol, nad, so4

Details for d4e13a1

PDB Entry: 4e13 (more details), 2.08 Å

PDB Description: Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
PDB Compounds: (A:) Diketoreductase

SCOPe Domain Sequences for d4e13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e13a1 c.2.1.0 (A:1-189) automated matches {Acinetobacter baylyi [TaxId: 202950]}
mtgitnvtvlgtgvlgsqiafqtafhgfavtaydintdaldaakkrfeglaavyekevag
aadgaaqkalggirysddlaqavkdadlvieavpesldlkrdiytklgelapaktifatn
sstllpsdlvgytgrgdkflalhfanhvwvnntaevmgttktdpevyqqvvefasaigmv
pielkkeka

SCOPe Domain Coordinates for d4e13a1:

Click to download the PDB-style file with coordinates for d4e13a1.
(The format of our PDB-style files is described here.)

Timeline for d4e13a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e13a2