Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Acinetobacter baylyi [TaxId:202950] [226522] (3 PDB entries) |
Domain d4e13a1: 4e13 A:1-189 [220141] Other proteins in same PDB: d4e13a2 automated match to d1f17a2 complexed with 1pe, gol, nad, so4 |
PDB Entry: 4e13 (more details), 2.08 Å
SCOPe Domain Sequences for d4e13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e13a1 c.2.1.0 (A:1-189) automated matches {Acinetobacter baylyi [TaxId: 202950]} mtgitnvtvlgtgvlgsqiafqtafhgfavtaydintdaldaakkrfeglaavyekevag aadgaaqkalggirysddlaqavkdadlvieavpesldlkrdiytklgelapaktifatn sstllpsdlvgytgrgdkflalhfanhvwvnntaevmgttktdpevyqqvvefasaigmv pielkkeka
Timeline for d4e13a1: