SCOPe 2.04: Domain d4e0bc2: 4e0b C:146-309

Lineage for d4e0bc2 (4e0b C:146-309)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (24 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226333] (1 PDB entry)

8. Domain d4e0bc2: 4e0b C:146-309 [220132]
   Other proteins in same PDB: d4e0ba1, d4e0bb1, d4e0bc1, d4e0bd1
   automated match to d2cmda2
   complexed with act

Details for d4e0bc2

PDB Entry: 4e0b, 2.17 Å

PDB Description: 2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d4e0bc2:

Sequence; same for both SEQRES and ATOM records:

>d4e0bc2 d.162.1.0 (C:146-309) automated matches {Vibrio vulnificus [TaxId: 216895]}
vttldvirsetfvaelkgqdpgevrvpvigghsgvtilpllsqvegvefsdeeiaaltkr
iqnagtevveakagggsatlsmgqaacrfglalvkalqgeevieyayvegngehasffaq
pvklgkegveeilpygelsdfekaaldgmletlnsdiqigvdfv

Timeline for d4e0bc2:

• d4e0bc2 first appeared in SCOPe 2.03
  
• d4e0bc2 appears in SCOPe 2.05
  
• d4e0bc2 appears in the current release, SCOPe 2.08