Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Vibrio vulnificus [TaxId:216895] [226333] (1 PDB entry) |
Domain d4e0ba2: 4e0b A:146-309 [220128] Other proteins in same PDB: d4e0ba1, d4e0bb1, d4e0bc1, d4e0bd1 automated match to d2cmda2 complexed with act |
PDB Entry: 4e0b (more details), 2.17 Å
SCOPe Domain Sequences for d4e0ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e0ba2 d.162.1.0 (A:146-309) automated matches {Vibrio vulnificus [TaxId: 216895]} vttldvirsetfvaelkgqdpgevrvpvigghsgvtilpllsqvegvefsdeeiaaltkr iqnagtevveakagggsatlsmgqaacrfglalvkalqgeevieyayvegngehasffaq pvklgkegveeilpygelsdfekaaldgmletlnsdiqigvdfv
Timeline for d4e0ba2: