Lineage for d4dz8a1 (4dz8 A:236-339)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293085Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1293086Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1293089Domain d4dz8a1: 4dz8 A:236-339 [220115]
    Other proteins in same PDB: d4dz8a2, d4dz8b2
    automated match to d1hzhh3

Details for d4dz8a1

PDB Entry: 4dz8 (more details), 1.91 Å

PDB Description: human igg1 fc fragment heterodimer
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4dz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz8a1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4dz8a1:

Click to download the PDB-style file with coordinates for d4dz8a1.
(The format of our PDB-style files is described here.)

Timeline for d4dz8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dz8a2