SCOPe 2.04: Domain d4dyda2: 4dyd A:190-283

Lineage for d4dyda2 (4dyd A:190-283)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Acinetobacter baylyi [TaxId:202950] [226523] (3 PDB entries)

8. Domain d4dyda2: 4dyd A:190-283 [220105]
   Other proteins in same PDB: d4dyda1
   automated match to d1f17a1
   complexed with gol, nad, po4, so4

Details for d4dyda2

PDB Entry: 4dyd, 1.95 Å

PDB Description: Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase

PDB Compounds: (A:) Diketoreductase

SCOPe Domain Sequences for d4dyda2:

Sequence; same for both SEQRES and ATOM records:

>d4dyda2 a.100.1.0 (A:190-283) automated matches {Acinetobacter baylyi [TaxId: 202950]}
gyvlnsllvplldaaaellvdgiadpetidktwrigtgapkgpfeifdivglttayniss
vsgpkqrefaaylkenyidkgklglatgegfyry

Timeline for d4dyda2:

• d4dyda2 first appeared in SCOPe 2.03
  
• d4dyda2 appears in SCOPe 2.05
  
• d4dyda2 appears in the current release, SCOPe 2.08