SCOPe 2.04: Domain d4dyda1: 4dyd A:1-189

Lineage for d4dyda1 (4dyd A:1-189)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Acinetobacter baylyi [TaxId:202950] [226522] (3 PDB entries)

8. Domain d4dyda1: 4dyd A:1-189 [220104]
   Other proteins in same PDB: d4dyda2
   automated match to d1f17a2
   complexed with gol, nad, po4, so4

Details for d4dyda1

PDB Entry: 4dyd, 1.95 Å

PDB Description: Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase

PDB Compounds: (A:) Diketoreductase

SCOPe Domain Sequences for d4dyda1:

Sequence; same for both SEQRES and ATOM records:

>d4dyda1 c.2.1.0 (A:1-189) automated matches {Acinetobacter baylyi [TaxId: 202950]}
mtgitnvtvlgtgvlgsqiafqtafhgfavtaydintdaldaakkrfeglaavyekevag
aadgaaqkalggirysddlaqavkdadlvieavpesldlkrdiytklgelapaktifatn
sstllpsdlvgytgrgdkflalhfanhvwvnntaevmgttktdpevyqqvvefasaigmv
pielkkeka

Timeline for d4dyda1:

• d4dyda1 first appeared in SCOPe 2.03
  
• d4dyda1 appears in SCOPe 2.05
  
• d4dyda1 appears in the current release, SCOPe 2.08