Lineage for d4dxja_ (4dxj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749618Species Trypanosoma cruzi [TaxId:5693] [196823] (14 PDB entries)
  8. 1749628Domain d4dxja_: 4dxj A: [220096]
    automated match to d4dwba_
    complexed with 0m9, act, ipe, mg, peg, pge, so4

Details for d4dxja_

PDB Entry: 4dxj (more details), 2.35 Å

PDB Description: Crystal structure of Trypanosome cruzi farnesyl diphosphate synthase in complex with [2-(n-propylamino)ethane-1,1-diyl]bisphosphonic acid and Mg2+
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4dxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxja_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

SCOPe Domain Coordinates for d4dxja_:

Click to download the PDB-style file with coordinates for d4dxja_.
(The format of our PDB-style files is described here.)

Timeline for d4dxja_: