Lineage for d4dwjd_ (4dwj D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129140Species Staphylococcus aureus [TaxId:158878] [226321] (5 PDB entries)
  8. 2129151Domain d4dwjd_: 4dwj D: [220067]
    automated match to d2ccja_
    complexed with tmp

Details for d4dwjd_

PDB Entry: 4dwj (more details), 2.74 Å

PDB Description: crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
PDB Compounds: (D:) thymidylate kinase

SCOPe Domain Sequences for d4dwjd_:

Sequence, based on SEQRES records: (download)

>d4dwjd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records): (download)

>d4dwjd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihqrfksvnad
qplenvvedtyqtiikylek

SCOPe Domain Coordinates for d4dwjd_:

Click to download the PDB-style file with coordinates for d4dwjd_.
(The format of our PDB-style files is described here.)

Timeline for d4dwjd_: