Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [226321] (5 PDB entries) |
Domain d4dwjb_: 4dwj B: [220065] automated match to d2ccja_ complexed with tmp |
PDB Entry: 4dwj (more details), 2.74 Å
SCOPe Domain Sequences for d4dwjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dwjb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv nadqplenvvedtyqtiikylek
Timeline for d4dwjb_: