SCOPe 2.03: Domain d4dw2u_: 4dw2 U:

Lineage for d4dw2u_ (4dw2 U:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d4dw2u_: 4dw2 U: [220057]
   Other proteins in same PDB: d4dw2l1, d4dw2l2
   automated match to d4fuba_
   complexed with so4

Details for d4dw2u_

PDB Entry: 4dw2, 2.97 Å

PDB Description: The crystal structure of uPA in complex with the Fab fragment of mAb-112

PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4dw2u_:

Sequence, based on SEQRES records:

>d4dw2u_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivylgrsr
lnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqtialpsm
yndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttkmlcaa
dpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwirsht
k

Sequence, based on observed residues (ATOM records):

>d4dw2u_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fttienqpwfaaiyrrvtyvcggslispcwvisathcfidypkkedyivylgrsrlnsnt
qgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqtialpsmyndpq
fgtsceitgfgkeqstdylypeqlkmtvvklishrecyygsevttkmlcaadpqwqgdsg
gplvcslqgrmtltgivswgrkpgvytrvshflpwirshtk

Timeline for d4dw2u_:

• d4dw2u_ is new in SCOPe 2.03-stable
  
• d4dw2u_ appears in SCOPe 2.04
  
• d4dw2u_ appears in the current release, SCOPe 2.08