SCOPe 2.06: Domain d4dw2l2: 4dw2 L:108-214

Lineage for d4dw2l2 (4dw2 L:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d4dw2l2: 4dw2 L:108-214 [220056]
   Other proteins in same PDB: d4dw2l1, d4dw2u_
   automated match to d1tqbc2
   complexed with so4

Details for d4dw2l2

PDB Entry: 4dw2, 2.97 Å

PDB Description: The crystal structure of uPA in complex with the Fab fragment of mAb-112

PDB Compounds: (L:) Fab fragment of pro-uPA antibody mAb-112

SCOPe Domain Sequences for d4dw2l2:

Sequence, based on SEQRES records:

>d4dw2l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d4dw2l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatktstspivksfnrnec

Timeline for d4dw2l2:

• d4dw2l2 first appeared in SCOPe 2.03
  
• d4dw2l2 appears in SCOPe 2.05
  
• d4dw2l2 appears in SCOPe 2.07
  
• d4dw2l2 appears in the current release, SCOPe 2.08