Lineage for d4dvhb2 (4dvh B:89-201)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647961Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1647962Protein automated matches [226860] (25 species)
    not a true protein
  7. 1648079Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries)
  8. 1648081Domain d4dvhb2: 4dvh B:89-201 [220054]
    Other proteins in same PDB: d4dvha1, d4dvhb1
    automated match to d1jr9a2
    complexed with fe

Details for d4dvhb2

PDB Entry: 4dvh (more details), 2.23 Å

PDB Description: Crystal structure of Trypanosoma cruzi mitochondrial iron superoxide dismutase
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4dvhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dvhb2 d.44.1.0 (B:89-201) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ngkampkslesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna
gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqai

SCOPe Domain Coordinates for d4dvhb2:

Click to download the PDB-style file with coordinates for d4dvhb2.
(The format of our PDB-style files is described here.)

Timeline for d4dvhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dvhb1