Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226482] (2 PDB entries) |
Domain d4dvha1: 4dvh A:0-88 [220051] Other proteins in same PDB: d4dvha2, d4dvhb2 automated match to d1jr9a1 complexed with fe |
PDB Entry: 4dvh (more details), 2.23 Å
SCOPe Domain Sequences for d4dvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvha1 a.2.11.0 (A:0-88) automated matches {Trypanosoma cruzi [TaxId: 353153]} hapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksieeiila vandaekkglfnqaaqhfnhtfyfrcitp
Timeline for d4dvha1: