Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d4dvbl2: 4dvb L:109-215 [220049] Other proteins in same PDB: d4dvba_, d4dvbb1, d4dvbh_, d4dvbl1 automated match to d1tqbc2 complexed with pg4, so4 |
PDB Entry: 4dvb (more details), 1.93 Å
SCOPe Domain Sequences for d4dvbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvbl2 b.1.1.2 (L:109-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4dvbl2:
View in 3D Domains from other chains: (mouse over for more information) d4dvba_, d4dvbb1, d4dvbb2, d4dvbh_ |