SCOP 1.55: Domain d1a22b1: 1a22 B:233-328

Lineage for d1a22b1 (1a22 B:233-328)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)

8. Domain d1a22b1: 1a22 B:233-328 [22003]
   Other proteins in same PDB: d1a22a_

Details for d1a22b1

PDB Entry: 1a22, 2.6 Å

PDB Description: human growth hormone bound to single receptor

SCOP Domain Sequences for d1a22b1:

Sequence, based on SEQRES records:

>d1a22b1 b.1.2.1 (B:233-328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen
scyfnssftsiwipycikltsnggtvdekcfsvdei

Sequence, based on observed residues (ATOM records):

>d1a22b1 b.1.2.1 (B:233-328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtlgpiqlfytrrntqewtqewkecpdyvsagenscyfnssft
siwipycikltsnggtvdekcfsvdei

Timeline for d1a22b1:

• d1a22b1 appears in SCOP 1.57
  
• d1a22b1 appears in the current release, SCOPe 2.08