SCOPe 2.03: Domain d4dsua_: 4dsu A:

Lineage for d4dsua_ (4dsu A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d4dsua_: 4dsu A: [220001]
   automated match to d3gftb_
   complexed with bzi, gdp, mg

Details for d4dsua_

PDB Entry: 4dsu, 1.7 Å

PDB Description: Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity

PDB Compounds: (A:) GTPase KRas, isoform 2B

SCOPe Domain Sequences for d4dsua_:

Sequence, based on SEQRES records:

>d4dsua_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkkk

Sequence, based on observed residues (ATOM records):

>d4dsua_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsr
tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkekmskdgkkkkkk

Timeline for d4dsua_:

• d4dsua_ is new in SCOPe 2.03-stable
  
• d4dsua_ appears in SCOPe 2.04
  
• d4dsua_ appears in the current release, SCOPe 2.08, called d4dsua1