SCOP 1.65: Domain d1axib1: 1axi B:32-130

Lineage for d1axib1 (1axi B:32-130)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
   tandem of fibronectin type III domains

8. Domain d1axib1: 1axi B:32-130 [21997]
   Other proteins in same PDB: d1axia_

Details for d1axib1

PDB Entry: 1axi, 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

SCOP Domain Sequences for d1axib1:

Sequence, based on SEQRES records:

>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdevhhgtknegpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiaipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records):

>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdegpiqlfytrrnewkecpdyvsagenscyfnssftsiai
pycikltsnggtvdekcfsvdeivq

Timeline for d1axib1:

• d1axib1 first appeared (with stable ids) in SCOP 1.55
  
• d1axib1 appears in SCOP 1.63
  
• d1axib1 appears in SCOP 1.67
  
• d1axib1 appears in the current release, SCOPe 2.08