Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Methanosarcina mazei [TaxId:192952] [226315] (1 PDB entry) |
Domain d4dpoa1: 4dpo A:3-96 [219923] Other proteins in same PDB: d4dpoa2, d4dpob2 automated match to d1x7vc_ |
PDB Entry: 4dpo (more details), 2.73 Å
SCOPe Domain Sequences for d4dpoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dpoa1 d.58.4.0 (A:3-96) automated matches {Methanosarcina mazei [TaxId: 192952]} airvvaknqvkpekvqefmnlckslieetlkeegcidygvyqelenpeiltmleewkdeg sldqhirsdhfkeifpllsecldketeiniyrkk
Timeline for d4dpoa1: