SCOPe 2.03: Domain d4do5a1: 4do5 A:18-309

Lineage for d4do5a1 (4do5 A:18-309)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225770] (7 PDB entries)

8. Domain d4do5a1: 4do5 A:18-309 [219888]
   Other proteins in same PDB: d4do5a2, d4do5b2
   automated match to d1ktba2
   complexed with cit, dgj, gol, nag

Details for d4do5a1

PDB Entry: 4do5, 1.51 Å

PDB Description: pharmacological chaperones for human alpha-n-acetylgalactosaminidase

PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d4do5a1:

Sequence; same for both SEQRES and ATOM records:

>d4do5a1 c.1.8.1 (A:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp

Timeline for d4do5a1:

• d4do5a1 is new in SCOPe 2.03-stable
  
• d4do5a1 appears in SCOPe 2.04
  
• d4do5a1 appears in the current release, SCOPe 2.08