SCOPe 2.03: Domain d4dnxb2: 4dnx B:174-396

Lineage for d4dnxb2 (4dnx B:174-396)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
   automatically mapped to Pfam PF01747

6. Protein automated matches [226985] (1 species)
   not a true protein

7. Species Allochromatium vinosum [TaxId:572477] [226589] (1 PDB entry)

8. Domain d4dnxb2: 4dnx B:174-396 [219877]
   Other proteins in same PDB: d4dnxa1, d4dnxb1
   automated match to d1jhda2
   complexed with mes

Details for d4dnxb2

PDB Entry: 4dnx, 1.6 Å

PDB Description: the structure of the atp sulfurylase from allochromatium vinosum in the open state

PDB Compounds: (B:) sulfate adenylyltransferase

SCOPe Domain Sequences for d4dnxb2:

Sequence; same for both SEQRES and ATOM records:

>d4dnxb2 c.26.1.5 (B:174-396) automated matches {Allochromatium vinosum [TaxId: 572477]}
pdtfrtaveirheiqergwqkivafqtrnpmhraheelckmameaveadgvvihmllgql
kpgdipapvrdaairtmaelyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi
igrdhagvgdyygpfdaqtifddavptdvlaieifradntayskklgrvvmmrdapdhtp
ddfiqlsgtrvremlgqgeapppefsrpevaqilmdyyrslpq

Timeline for d4dnxb2:

• d4dnxb2 is new in SCOPe 2.03-stable
  
• d4dnxb2 appears in SCOPe 2.04
  
• d4dnxb2 appears in the current release, SCOPe 2.08