SCOPe 2.08: Domain d4dnxb1: 4dnx B:1-173

Lineage for d4dnxb1 (4dnx B:1-173)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (10 species)
   not a true protein

7. Species Allochromatium vinosum [TaxId:572477] [226588] (1 PDB entry)

8. Domain d4dnxb1: 4dnx B:1-173 [219876]
   Other proteins in same PDB: d4dnxa2, d4dnxb2
   automated match to d1jhda1
   complexed with mes

Details for d4dnxb1

PDB Entry: 4dnx, 1.6 Å

PDB Description: the structure of the atp sulfurylase from allochromatium vinosum in the open state

PDB Compounds: (B:) sulfate adenylyltransferase

SCOPe Domain Sequences for d4dnxb1:

Sequence; same for both SEQRES and ATOM records:

>d4dnxb1 b.122.1.0 (B:1-173) automated matches {Allochromatium vinosum [TaxId: 572477]}
mikpvgsdelrprfvydpeqhhrlsseaeslpsvivssqaagnavmlgagyfspldgfmn
ladalssaqsmtltdgrffpvpllcllesadaiagatrialrdpnvegnpvlavmdvtav
eqvsdaqmalmteqvygtsdpkhpgvetfnsqgrtaisgpiqvlnfsyfqtdf

Timeline for d4dnxb1:

• d4dnxb1 first appeared in SCOPe 2.03
  
• d4dnxb1 appears in SCOPe 2.07