Lineage for d4dllb2 (4dll B:191-318)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006919Species Polaromonas sp. [TaxId:296591] [226305] (1 PDB entry)
  8. 2006921Domain d4dllb2: 4dll B:191-318 [219852]
    Other proteins in same PDB: d4dlla1, d4dllb1
    automated match to d1vpda1
    complexed with so4

Details for d4dllb2

PDB Entry: 4dll (more details), 2.11 Å

PDB Description: Crystal structure of a 2-hydroxy-3-oxopropionate reductase from Polaromonas sp. JS666
PDB Compounds: (B:) 2-hydroxy-3-oxopropionate reductase

SCOPe Domain Sequences for d4dllb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dllb2 a.100.1.0 (B:191-318) automated matches {Polaromonas sp. [TaxId: 296591]}
phgsgqltklanqmivgitigavaeallfatkggadmakvkeaitggfadsrvlqlhgqr
mverdfaprarlsiqlkdmrnalataqeigfdapitglfeqlyaegvehgltdldqsglf
velasrng

SCOPe Domain Coordinates for d4dllb2:

Click to download the PDB-style file with coordinates for d4dllb2.
(The format of our PDB-style files is described here.)

Timeline for d4dllb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dllb1