SCOP 1.65: Domain d1mfn_1: 1mfn 1-92

Lineage for d1mfn_1 (1mfn 1-92)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Fibronectin, different Fn3 modules [49270] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries)

8. Domain d1mfn_1: 1mfn 1-92 [21984]

Details for d1mfn_1

PDB Entry: 1mfn

PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 20 structures

SCOP Domain Sequences for d1mfn_1:

Sequence; same for both SEQRES and ATOM records:

>d1mfn_1 b.1.2.1 (1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus)}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs

Timeline for d1mfn_1:

• d1mfn_1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfn_1 appears in SCOP 1.63
  
• d1mfn_1 appears in SCOP 1.67
  
• d1mfn_1 appears in the current release, SCOPe 2.08, called d1mfna1