SCOPe 2.05: Domain d4dkib2: 4dki B:139-327

Lineage for d4dkib2 (4dki B:139-327)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (6 PDB entries)
   Uniprot O54286 27-668

8. Domain d4dkib2: 4dki B:139-327 [219831]
   Other proteins in same PDB: d4dkia1, d4dkia3, d4dkib1, d4dkib3
   automated match to d1vqqa2
   complexed with bct, cd, cl, rb6

Details for d4dkib2

PDB Entry: 4dki, 2.9 Å

PDB Description: Structural Insights into the Anti- Methicillin-Resistant Staphylococcus aureus (MRSA) Activity of Ceftobiprole

PDB Compounds: (B:) Penicillin-binding protein 2'

SCOPe Domain Sequences for d4dkib2:

Sequence; same for both SEQRES and ATOM records:

>d4dkib2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d4dkib2:

• d4dkib2 first appeared in SCOPe 2.03
  
• d4dkib2 appears in SCOPe 2.04
  
• d4dkib2 appears in SCOPe 2.06
  
• d4dkib2 appears in the current release, SCOPe 2.08