Lineage for d4dkfl1 (4dkf L:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033270Domain d4dkfl1: 4dkf L:1-106 [219823]
    Other proteins in same PDB: d4dkfl2, d4dkfm2
    automated match to d1dn0a1

Details for d4dkfl1

PDB Entry: 4dkf (more details), 2.61 Å

PDB Description: crystal structure of human interleukin-34 bound to fab2
PDB Compounds: (L:) FAb2 Light Chain

SCOPe Domain Sequences for d4dkfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dkfl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsissylawyqqkpgkapklliygassrasgvps
rfsgsgsgtdftltisslqpedfatyycqqywsepvtfgqgtkvei

SCOPe Domain Coordinates for d4dkfl1:

Click to download the PDB-style file with coordinates for d4dkfl1.
(The format of our PDB-style files is described here.)

Timeline for d4dkfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dkfl2