Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) |
Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
Protein automated matches [227090] (1 species) not a true protein |
Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries) |
Domain d4dhlb1: 4dhl B:8-120 [219761] Other proteins in same PDB: d4dhla2, d4dhlb2, d4dhlc2, d4dhld2 automated match to d2qfra1 complexed with 0k7, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dhl (more details), 2.3 Å
SCOPe Domain Sequences for d4dhlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhlb1 b.1.12.0 (B:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d4dhlb1: