Lineage for d1fnha1 (1fnh A:3-92)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290576Protein Fibronectin, different Fn3 modules [49270] (2 species)
  7. 290577Species Human (Homo sapiens) [TaxId:9606] [49271] (7 PDB entries)
  8. 290583Domain d1fnha1: 1fnh A:3-92 [21976]

Details for d1fnha1

PDB Entry: 1fnh (more details), 2.8 Å

PDB Description: crystal structure of heparin and integrin binding segment of human fibronectin

SCOP Domain Sequences for d1fnha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
paptdlkftqvtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvsgl
mvatkyevsvyalkdtltsrpaqgvvttle

SCOP Domain Coordinates for d1fnha1:

Click to download the PDB-style file with coordinates for d1fnha1.
(The format of our PDB-style files is described here.)

Timeline for d1fnha1: