SCOPe 2.06: Domain d4dgec_: 4dge C:

Lineage for d4dgec_ (4dge C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d4dgec_: 4dge C: [219749]
   Other proteins in same PDB: d4dgea_, d4dgeb_
   automated match to d4dgac_
   mutant

Details for d4dgec_

PDB Entry: 4dge, 2.2 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant, HIV-1 CA(O-loop) complex

PDB Compounds: (C:) capsid protein

SCOPe Domain Sequences for d4dgec_:

Sequence, based on SEQRES records:

>d4dgec_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivr

Sequence, based on observed residues (ATOM records):

>d4dgec_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamq
mlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmthnppipvg
eiykrwiilglnkivr

Timeline for d4dgec_:

• d4dgec_ first appeared in SCOPe 2.03
  
• d4dgec_ appears in SCOPe 2.05
  
• d4dgec_ appears in SCOPe 2.07
  
• d4dgec_ appears in the current release, SCOPe 2.08