SCOPe 2.05: Domain d4dg1a2: 4dg1 A:430-549

Lineage for d4dg1a2 (4dg1 A:430-549)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (18 PDB entries)

8. Domain d4dg1a2: 4dg1 A:430-549 [219745]
   Other proteins in same PDB: d4dg1a1, d4dg1b_
   automated match to d1hqea1
   complexed with edo, gol, mg; mutant

Details for d4dg1a2

PDB Entry: 4dg1, 2.15 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase (RT) with polymorphism mutation K172A and K173A

PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d4dg1a2:

Sequence; same for both SEQRES and ATOM records:

>d4dg1a2 c.55.3.0 (A:430-549) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd

Timeline for d4dg1a2:

• d4dg1a2 first appeared in SCOPe 2.03
  
• d4dg1a2 appears in SCOPe 2.04
  
• d4dg1a2 appears in SCOPe 2.06
  
• d4dg1a2 appears in the current release, SCOPe 2.08