SCOPe 2.06: Domain d4dexa1: 4dex A:36-224

Lineage for d4dexa1 (4dex A:36-224)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
   Uniprot P54288

8. Domain d4dexa1: 4dex A:36-224 [219729]
   Other proteins in same PDB: d4dexa2
   automated match to d1vyub1

Details for d4dexa1

PDB Entry: 4dex, 2 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.

PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4dexa1:

Sequence, based on SEQRES records:

>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh
vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkte
htppydvv

Sequence, based on observed residues (ATOM records):

>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh
vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefkltppydvv

Timeline for d4dexa1:

• d4dexa1 first appeared in SCOPe 2.03
  
• d4dexa1 appears in SCOPe 2.05
  
• d4dexa1 appears in SCOPe 2.07
  
• d4dexa1 appears in the current release, SCOPe 2.08