SCOPe 2.06: Domain d4de3a_: 4de3 A:

Lineage for d4de3a_ (4de3 A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d4de3a_: 4de3 A: [219717]
   automated match to d2p74a_
   complexed with dms, dn8

Details for d4de3a_

PDB Entry: 4de3, 1.44 Å

PDB Description: CTX-M-9 class A beta-lactamase complexed with compound 4

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4de3a_:

Sequence; same for both SEQRES and ATOM records:

>d4de3a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d4de3a_:

• d4de3a_ first appeared in SCOPe 2.03
  
• d4de3a_ appears in SCOPe 2.05
  
• d4de3a_ appears in SCOPe 2.07
  
• d4de3a_ appears in the current release, SCOPe 2.08