Lineage for d4ddsa_ (4dds A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950053Species Escherichia coli [TaxId:562] [187306] (55 PDB entries)
  8. 1950086Domain d4ddsa_: 4dds A: [219709]
    automated match to d2p74a_
    complexed with 0j7, dms

Details for d4ddsa_

PDB Entry: 4dds (more details), 1.36 Å

PDB Description: CTX-M-9 class A beta-lactamase complexed with compound 11
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4ddsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ddsa_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

SCOPe Domain Coordinates for d4ddsa_:

Click to download the PDB-style file with coordinates for d4ddsa_.
(The format of our PDB-style files is described here.)

Timeline for d4ddsa_: