Lineage for d4dd5a2 (4dd5 A:275-396)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917566Species Clostridium difficile [TaxId:272563] [226291] (2 PDB entries)
  8. 2917568Domain d4dd5a2: 4dd5 A:275-396 [219699]
    automated match to d1ulqa2

Details for d4dd5a2

PDB Entry: 4dd5 (more details), 1.25 Å

PDB Description: biosynthetic thiolase (thla1) from clostridium difficile
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4dd5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dd5a2 c.95.1.0 (A:275-396) automated matches {Clostridium difficile [TaxId: 272563]}
eplativsygtagvdpkimgygpvpatkkaleaanmtiedidlveaneafaaqsvavird
lnidmnkvnvnggaiaighpigcsgarilttllyemkrrdaktglatlcigggmgttliv
kr

SCOPe Domain Coordinates for d4dd5a2:

Click to download the PDB-style file with coordinates for d4dd5a2.
(The format of our PDB-style files is described here.)

Timeline for d4dd5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dd5a1