Lineage for d1a21b1 (1a21 B:4-106)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 455036Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 455062Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)
  8. 455065Domain d1a21b1: 1a21 B:4-106 [21969]

Details for d1a21b1

PDB Entry: 1a21 (more details), 2.35 Å

PDB Description: tissue factor (tf) from rabbit

SCOP Domain Sequences for d1a21b1:

Sequence, based on SEQRES records: (download)

>d1a21b1 b.1.2.1 (B:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnl

Sequence, based on observed residues (ATOM records): (download)

>d1a21b1 b.1.2.1 (B:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsypanttgfpeeppfrnspeftpyldtnl

SCOP Domain Coordinates for d1a21b1:

Click to download the PDB-style file with coordinates for d1a21b1.
(The format of our PDB-style files is described here.)

Timeline for d1a21b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a21b2