SCOP 1.55: Domain d1a21b1: 1a21 B:4-106

Lineage for d1a21b1 (1a21 B:4-106)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)

8. Domain d1a21b1: 1a21 B:4-106 [21969]

Details for d1a21b1

PDB Entry: 1a21, 2.35 Å

PDB Description: tissue factor (tf) from rabbit

SCOP Domain Sequences for d1a21b1:

Sequence, based on SEQRES records:

>d1a21b1 b.1.2.1 (B:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnl

Sequence, based on observed residues (ATOM records):

>d1a21b1 b.1.2.1 (B:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsypanttgfpeeppfrnspeftpyldtnl

Timeline for d1a21b1:

• d1a21b1 appears in SCOP 1.57
  
• d1a21b1 appears in the current release, SCOPe 2.08