Lineage for d4dcqa2 (4dcq A:116-218)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766704Domain d4dcqa2: 4dcq A:116-218 [219687]
    automated match to d1aqkl2
    complexed with edo

Details for d4dcqa2

PDB Entry: 4dcq (more details), 1.94 Å

PDB Description: Crystal Structure of the Fab Fragment of 3B5H10, an Antibody-Specific for Extended Polyglutamine Repeats (orthorhombic form)
PDB Compounds: (A:) 3B5H10 FAB light chain

SCOPe Domain Sequences for d4dcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dcqa2 b.1.1.0 (A:116-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkk
gnkfmassflhltsdqwrshqsftcqvthegdtvekslspalr

SCOPe Domain Coordinates for d4dcqa2:

Click to download the PDB-style file with coordinates for d4dcqa2.
(The format of our PDB-style files is described here.)

Timeline for d4dcqa2: