SCOPe 2.03: Domain d4dcqa2: 4dcq A:116-218

Lineage for d4dcqa2 (4dcq A:116-218)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d4dcqa2: 4dcq A:116-218 [219687]
   automated match to d1aqkl2
   complexed with edo

Details for d4dcqa2

PDB Entry: 4dcq, 1.94 Å

PDB Description: Crystal Structure of the Fab Fragment of 3B5H10, an Antibody-Specific for Extended Polyglutamine Repeats (orthorhombic form)

PDB Compounds: (A:) 3B5H10 FAB light chain

SCOPe Domain Sequences for d4dcqa2:

Sequence; same for both SEQRES and ATOM records:

>d4dcqa2 b.1.1.0 (A:116-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkk
gnkfmassflhltsdqwrshqsftcqvthegdtvekslspalr

Timeline for d4dcqa2:

• d4dcqa2 is new in SCOPe 2.03-stable
  
• d4dcqa2 appears in SCOPe 2.04
  
• d4dcqa2 appears in the current release, SCOPe 2.08