SCOPe 2.05: Domain d4dbba_: 4dbb A:

Lineage for d4dbba_ (4dbb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein automated matches [190580] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226324] (1 PDB entry)

8. Domain d4dbba_: 4dbb A: [219665]
   automated match to d1x11a_
   complexed with acy, cl, gol, ipa

Details for d4dbba_

PDB Entry: 4dbb, 1.9 Å

PDB Description: the ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region

PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family A member 1

SCOPe Domain Sequences for d4dbba_:

Sequence, based on SEQRES records:

>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikpegesqpmtevdlfistq
rikvlnadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqlia
qsigqafsvayqeflranginpedlsqkeysdllntq

Sequence, based on observed residues (ATOM records):

>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikqpmtevdlfistqrikvl
nadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqliaqsigq
afsvayqeflrainpedlsqkeysdllntq

Timeline for d4dbba_:

• d4dbba_ first appeared in SCOPe 2.03
  
• d4dbba_ appears in SCOPe 2.04
  
• d4dbba_ appears in SCOPe 2.06
  
• d4dbba_ appears in the current release, SCOPe 2.08