Lineage for d4dbba_ (4dbb A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551068Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1551133Protein automated matches [190580] (4 species)
    not a true protein
  7. 1551145Species Norway rat (Rattus norvegicus) [TaxId:10116] [226324] (1 PDB entry)
  8. 1551146Domain d4dbba_: 4dbb A: [219665]
    automated match to d1x11a_
    complexed with acy, cl, gol, ipa

Details for d4dbba_

PDB Entry: 4dbb (more details), 1.9 Å

PDB Description: the ptb domain of mint1 is autoinhibited by a helix in the c-terminal linker region
PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family A member 1

SCOPe Domain Sequences for d4dbba_:

Sequence, based on SEQRES records: (download)

>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikpegesqpmtevdlfistq
rikvlnadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqlia
qsigqafsvayqeflranginpedlsqkeysdllntq

Sequence, based on observed residues (ATOM records): (download)

>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikqpmtevdlfistqrikvl
nadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqliaqsigq
afsvayqeflrainpedlsqkeysdllntq

SCOPe Domain Coordinates for d4dbba_:

Click to download the PDB-style file with coordinates for d4dbba_.
(The format of our PDB-style files is described here.)

Timeline for d4dbba_: