Lineage for d4dalf_ (4dal F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876445Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 1876511Domain d4dalf_: 4dal F: [219650]
    automated match to d1bxsa_
    complexed with gol

Details for d4dalf_

PDB Entry: 4dal (more details), 2.3 Å

PDB Description: Crystal structure of Putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021
PDB Compounds: (F:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4dalf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dalf_ c.82.1.0 (F:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg

SCOPe Domain Coordinates for d4dalf_:

Click to download the PDB-style file with coordinates for d4dalf_.
(The format of our PDB-style files is described here.)

Timeline for d4dalf_: