SCOPe 2.01: Domain d1ahwc2: 1ahw C:107-211

Lineage for d1ahwc2 (1ahw C:107-211)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (12 PDB entries)
   Uniprot P13726 33-242

8. Domain d1ahwc2: 1ahw C:107-211 [21964]
   Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc2

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

PDB Compounds: (C:) tissue factor

SCOPe Domain Sequences for d1ahwc2:

Sequence; same for both SEQRES and ATOM records:

>d1ahwc2 b.1.2.1 (C:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d1ahwc2:

• d1ahwc2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwc2 appears in SCOP 1.75
  
• d1ahwc2 appears in SCOPe 2.02
  
• d1ahwc2 appears in the current release, SCOPe 2.08