SCOP 1.55: Domain d1ahwc1: 1ahw C:4-106

Lineage for d1ahwc1 (1ahw C:4-106)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)

8. Domain d1ahwc1: 1ahw C:4-106 [21963]
   Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc1

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwc1:

Sequence, based on SEQRES records:

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records):

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

Timeline for d1ahwc1:

• d1ahwc1 appears in SCOP 1.57
  
• d1ahwc1 appears in the current release, SCOPe 2.08