Lineage for d4d9lm1 (4d9l M:1-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032699Domain d4d9lm1: 4d9l M:1-108 [219622]
    Other proteins in same PDB: d4d9ll2, d4d9lm2, d4d9ln2, d4d9lo2
    automated match to d1q1jl1

Details for d4d9lm1

PDB Entry: 4d9l (more details), 2.48 Å

PDB Description: fab structure of anti-hiv-1 gp120 v2 mab 697
PDB Compounds: (M:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 697

SCOPe Domain Sequences for d4d9lm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9lm1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsgapgqrvtisctgsssnigahydvhwyqqlpgtapklliygnsnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgyvfgtgtkvtvlgq

SCOPe Domain Coordinates for d4d9lm1:

Click to download the PDB-style file with coordinates for d4d9lm1.
(The format of our PDB-style files is described here.)

Timeline for d4d9lm1: