SCOPe 2.03: Domain d4d9ll2: 4d9l L:109-209

Lineage for d4d9ll2 (4d9l L:109-209)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d4d9ll2: 4d9l L:109-209 [219621]
Other proteins in same PDB: d4d9ll1, d4d9lm1, d4d9ln1, d4d9lo1
automated match to d1q1jl2

Details for d4d9ll2

PDB Entry: 4d9l (more details), 2.48 Å

PDB Description: fab structure of anti-hiv-1 gp120 v2 mab 697

PDB Compounds: (L:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 697

SCOPe Domain Sequences for d4d9ll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9ll2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4d9ll2:

Click to download the PDB-style file with coordinates for d4d9ll2.
(The format of our PDB-style files is described here.)

Timeline for d4d9ll2: